PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462950675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 286aa    MW: 32738.2 Da    PI: 9.9855
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462950675genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.62.5e-314797151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+iifss+g+lyeys+
  462950675 47 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIIFSSRGRLYEYSN 97
               79***********************************************95 PP

2K-box92.19.8e-311152114100
      K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                ss   ++e + ++++qe+akLk++i nLq+++R l+G+++ ++++++L+qLe +L+k+l kiR++Knell++++e++ ++e elq++n +L++++ee
  462950675 115 SSAGTTAEITIQHYKQESAKLKQQITNLQNSNRTLIGDSIATMNHRDLKQLEARLDKGLGKIRARKNELLCSELEYMERREMELQNDNLYLKSRVEE 211
                44455788899*********************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-363998IPR002100Transcription factor, MADS-box
CDDcd002654.82E-4139113No hitNo description
PRINTSPR004041.9E-304161IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004195IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-3142112IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.4174399IPR002100Transcription factor, MADS-box
PfamPF003194.2E-264895IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-306176IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-307697IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.805125215IPR002487Transcription factor, K-box
PfamPF014866.9E-23125209IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MKEKRSLQCT LTNSAGLKLK NPMSPGSGSA GAALEKSAGK GKKVEIKRIE NTTNRQVTFC  60
KRRNGLLKKA YELSVLCDAE IALIIFSSRG RLYEYSNNSV RATIERYKKV TSDNSSAGTT  120
AEITIQHYKQ ESAKLKQQIT NLQNSNRTLI GDSIATMNHR DLKQLEARLD KGLGKIRARK  180
NELLCSELEY MERREMELQN DNLYLKSRVE ENERAKQTAD MMGAPSTSEY QQSFLPYDPI  240
RSFLQFSIMQ QQQPSPQPQT SQYYPQQQDD RKLFNLDKWT LGDLRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n6j_A8e-1942120381Myocyte-specific enhancer factor 2B
1n6j_B8e-1942120381Myocyte-specific enhancer factor 2B
1tqe_P7e-1942120482Myocyte-specific enhancer factor 2B
1tqe_Q7e-1942120482Myocyte-specific enhancer factor 2B
1tqe_R7e-1942120482Myocyte-specific enhancer factor 2B
1tqe_S7e-1942120482Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0027251e-169KJ002725.1 Phyllostachys edulis MADS-box protein 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960599.11e-148PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-125MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLQ418761e-141Q41876_MAIZE; Uncharacterized protein
STRINGGRMZM2G052890_P011e-141(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.16e-82MIKC_MADS family protein